your shopping cart is empty.
arrowrightCONTACT
Choose your country Choose your country

Worldwide:
T: +49-30-6392-7878
X: +49-30-6392-7888

USA /Canada:
T: 1.888.578.2660
X: 1.888.578.2666

E-Mail:
peptide@jpt.com

Contact

Content follows

CATALOG PRODUCT FINDER

A2T-Beta-Amyloid (1-42); HFIP treated (0.5mg)

A2T-Beta-Amyloid (1-42); HFIP treated (0.5mg)
  
add to cart
 
 
 
Delivery in 2-5 days
284,00 €
284,00 €

Excluding tax
prices do not include tax. For shipment within Germany 19% MwSt will be included at checkout and in the invoice. For shipment within EU-countries you will need to provide the valid VAT number. International customers should note that all duties, import fees, and taxes are to be paid by the customer
and
shipping fees

A2T-Beta-Amyloid (1-42); HFIP treated (0.5mg)

Product Code: SP-Ab-25_0.5

Variant of human Amyloid beta A4 protein, where Ala 2 is replaced by a Threonine (Thr) (Swiss-Prot ID: P05067). HFIP treatment is performed to disrupt β-sheet and other unwanted secondary structures.
Amino Acid Sequence: DTEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Protein Name: Amyloid beta (A4) (alternative names: Abeta, Beta amyloid, APP)
Amount: 1 vial (0.5 mg)
Purity: >90% (HPLC-MS)
Delivery Format: Freeze dried in plastic vials 5
Application(s): In vitro staining, Binding experiments
Indication(s)/Topic(s): Neurodegenerative disease, Alzheimer's disease
Delivery Time: 2-5 days

JPT's Single Catalog Peptides
JPT Peptide Technologies has substantial, long-standing expertise in providing peptides, peptidomimetics, and proteins to the global scientific community. Our highly skilled and committed scientific staff ensures that the most appropriate methods and techniques are selected for every synthesis project. All of JPT's catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

Benefits of JPT's Single Catalog Peptides
- Whole production performed in a regulated European environment according to DIN EN ISO 9001:2015 & GCLP standards; audits welcome!
- Synthesis protocols designed to avoid toxic contaminants and side products
- Provision of freeze dried aliquots for enhanced stability
- Proven track record for applications in clinical studies

A2T-Beta-Amyloid (1-42); HFIP treated (0.5mg)

References:
Read References with Amyloid Beta A4 Peptides (abeta, aß)

Application Note
"Synthetic Amyloid Beta Peptides Aid Alzheimer Investigation"
Broersen et al., Application Note (2013) (full text)

Testimonial
Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source. We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.”
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

A2T-Beta-Amyloid (1-42); HFIP treated (0.5mg)

 
Code
Product Name
 
Price
Buy
SP-Ab-07_0.5
Beta-Amyloid (1-42); HFIP treated (0.5mg)
Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein
add to cart
SP-Ab-12_0.5
A21G-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein (natural variant)
add to cart
SP-Ab-15_0.5
D23N-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Iowa variant of human Amyloid beta A4 protein, where Asp 23 is replaced by an Asparagine (Asn)
add to cart
SP-Ab-09_0.5
D7N-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Tottori-Japanese variant of human Amyloid beta A4 protein, where Asp 7 is replaced by an Asparagine (Asn)
add to cart
SP-Ab-10_0.5
E11K-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Variant of human Amyloid beta A4 protein, where Glu 11 is replaced by a Lysine (Lys)
add to cart
SP-Ab-14_0.5
E22Q-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Dutch variant of human Amyloid beta A4 protein, where Glu 22 is replaced by a Glutamine (Gln)
add to cart
SP-Ab-11_0.5
E22G-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Arctic variant of human Amyloid beta A4 protein, where Glu 22 is replaced by a Glycine (Gly)
add to cart
SP-Ab-13_0.5
E22K-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Italian variant of human Amyloid beta A4 protein, where Glu 22 is replaced by a Lysine (Lys)
add to cart
SP-Ab-25_0.1
A2T-Beta-Amyloid (1-42); HFIP treated (0.1mg)
Variant of human Amyloid beta A4 protein, where Ala 2 is replaced by a Threonine (Thr)
add to cart
SP-Ab-26_0.5
A2V-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Variant of human Amyloid beta A4 protein, where Ala 2 is replaced by a Valine (Val)
add to cart

Description

Product Code: SP-Ab-25_0.5

Variant of human Amyloid beta A4 protein, where Ala 2 is replaced by a Threonine (Thr) (Swiss-Prot ID: P05067). HFIP treatment is performed to disrupt β-sheet and other unwanted secondary structures.
Amino Acid Sequence: DTEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Protein Name: Amyloid beta (A4) (alternative names: Abeta, Beta amyloid, APP)
Amount: 1 vial (0.5 mg)
Purity: >90% (HPLC-MS)
Delivery Format: Freeze dried in plastic vials 5
Application(s): In vitro staining, Binding experiments
Indication(s)/Topic(s): Neurodegenerative disease, Alzheimer's disease
Delivery Time: 2-5 days

JPT's Single Catalog Peptides
JPT Peptide Technologies has substantial, long-standing expertise in providing peptides, peptidomimetics, and proteins to the global scientific community. Our highly skilled and committed scientific staff ensures that the most appropriate methods and techniques are selected for every synthesis project. All of JPT's catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

Benefits of JPT's Single Catalog Peptides
- Whole production performed in a regulated European environment according to DIN EN ISO 9001:2015 & GCLP standards; audits welcome!
- Synthesis protocols designed to avoid toxic contaminants and side products
- Provision of freeze dried aliquots for enhanced stability
- Proven track record for applications in clinical studies

References

References:
Read References with Amyloid Beta A4 Peptides (abeta, aß)

Application Note
"Synthetic Amyloid Beta Peptides Aid Alzheimer Investigation"
Broersen et al., Application Note (2013) (full text)

Testimonial
Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source. We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.”
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

Documentation

Properties

Related Products

SP-Ab-07_0.5
Beta-Amyloid (1-42); HFIP treated (0.5mg)
Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein
add to cart
SP-Ab-12_0.5
A21G-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein (natural variant)
add to cart
SP-Ab-15_0.5
D23N-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Iowa variant of human Amyloid beta A4 protein, where Asp 23 is replaced by an Asparagine (Asn)
add to cart
SP-Ab-09_0.5
D7N-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Tottori-Japanese variant of human Amyloid beta A4 protein, where Asp 7 is replaced by an Asparagine (Asn)
add to cart
SP-Ab-10_0.5
E11K-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Variant of human Amyloid beta A4 protein, where Glu 11 is replaced by a Lysine (Lys)
add to cart
SP-Ab-14_0.5
E22Q-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Dutch variant of human Amyloid beta A4 protein, where Glu 22 is replaced by a Glutamine (Gln)
add to cart
SP-Ab-11_0.5
E22G-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Arctic variant of human Amyloid beta A4 protein, where Glu 22 is replaced by a Glycine (Gly)
add to cart
SP-Ab-13_0.5
E22K-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Italian variant of human Amyloid beta A4 protein, where Glu 22 is replaced by a Lysine (Lys)
add to cart
SP-Ab-25_0.1
A2T-Beta-Amyloid (1-42); HFIP treated (0.1mg)
Variant of human Amyloid beta A4 protein, where Ala 2 is replaced by a Threonine (Thr)
add to cart
SP-Ab-26_0.5
A2V-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Variant of human Amyloid beta A4 protein, where Ala 2 is replaced by a Valine (Val)
add to cart

Quality Assurance

All production is performed according to ISO 9001:2015 standards.

ISO 9001

 
Stay in touch and be the first to receive the latest news!

Contact us:

JPT Peptide Technologies GmbH
Volmerstrasse 5
12489 Berlin, Germany
Technical Support:
T: +49-30-6392-7878
X: +49-30-6392-7888
e-mail: peptide@jpt.com
USA & Canada:
T: 1.888.JPT.COM0 (1.888.578.2660)
X: 1.888.JPT.COM6 (1.888.578.2666)
e-mail: peptide@jpt.com