your shopping cart is empty.
Choose your country Choose your country

T: +49-30-6392-7878
X: +49-30-6392-7888

USA /Canada:
T: 1.888.578.2660
X: 1.888.578.2666



Content follows


S26C-Beta-Amyloid (1-40) Dimer; HFIP treated (0.1mg)

S26C-Beta-Amyloid (1-40) Dimer; HFIP treated (0.1mg)
add to cart
Delivery in 2-5 days
334,00 €
334,00 €

Excluding tax
Prices do not include tax. For shipment within Germany 16% MwSt will be included at checkout and in the invoice. For shipment within EU-countries you will need to provide the valid VAT number. International customers should note that all duties, import fees, and taxes are to be paid by the customer
shipping fees

S26C-Beta-Amyloid (1-40) Dimer; HFIP treated (0.1mg)

Product Code: SP-Ab-24_0.1

Homodimer of human Amyloid beta A4 peptide (1-40), where Ser 26 is replaced by an Cysteine (Cys) that is used for dimerization (Swiss-Prot ID: P05067). HFIP treatment is performed to disrupt β-sheet and other unwanted secondary structures.
Amino Acid Sequence: [DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV]2; dimerized via S-S brigde (Cys26)
Protein Name: Amyloid beta (A4) (alternative names: Abeta, Beta amyloid, APP)
Amount: 1 vial (0.1 mg)
Purity: >90% (HPLC-MS)
Delivery Format: Freeze dried in plastic vials
Application(s): In vitro staining, Binding experiments
Indication(s)/Topic(s): Neurodegenerative disease, Alzheimer's disease
Delivery Time: 2-5 days

JPT's Single Catalog Peptides
JPT Peptide Technologies has substantial, long-standing expertise in providing peptides, peptidomimetics, and proteins to the global scientific community. Our highly skilled and committed scientific staff ensures that the most appropriate methods and techniques are selected for every synthesis project. All of JPT's catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

Benefits of JPT's Single Catalog Peptides
- Whole production performed in a regulated European environment according to DIN EN ISO 9001:2015 & GCLP standards; audits welcome!
- Synthesis protocols designed to avoid toxic contaminants and side products
- Provision of freeze dried aliquots for enhanced stability
- Proven track record for applications in clinical studies

S26C-Beta-Amyloid (1-40) Dimer; HFIP treated (0.1mg)

Read References with Amyloid Beta A4 Peptides (abeta, aß)

Application Note
"Synthetic Amyloid Beta Peptides Aid Alzheimer Investigation"
Broersen et al., Application Note (2013) (full text)

"Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source. We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle."
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

S26C-Beta-Amyloid (1-40) Dimer; HFIP treated (0.1mg)

Product Name
Beta-Amyloid (1-40); HFIP treated (0.1mg)
Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein
add to cart
Beta-Amyloid (1-40)-Lys(Biotinoyl); HFIP (0.1mg)
Synthetic C-terminally biotinylated peptide derived from the N-terminal region of human Amyloid beta A4 protein
add to cart
Biotinoyl-Beta-Amyloid (1-40); HFIP treated (0.1mg)
Synthetic N-terminally biotinylated peptide derived from the N-terminal region of human Amyloid beta A4 protein
add to cart
S26C-Beta-Amyloid (1-40) Dimer; HFIP treated (0.5mg)
Homodimer of human Amyloid beta A4 peptide (1-40), where Ser 26 is replaced by an Cysteine (Cys) that is used for dimerization
add to cart


Product Code: SP-Ab-24_0.1

Homodimer of human Amyloid beta A4 peptide (1-40), where Ser 26 is replaced by an Cysteine (Cys) that is used for dimerization (Swiss-Prot ID: P05067). HFIP treatment is performed to disrupt β-sheet and other unwanted secondary structures.
Amino Acid Sequence: [DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV]2; dimerized via S-S brigde (Cys26)
Protein Name: Amyloid beta (A4) (alternative names: Abeta, Beta amyloid, APP)
Amount: 1 vial (0.1 mg)
Purity: >90% (HPLC-MS)
Delivery Format: Freeze dried in plastic vials
Application(s): In vitro staining, Binding experiments
Indication(s)/Topic(s): Neurodegenerative disease, Alzheimer's disease
Delivery Time: 2-5 days

JPT's Single Catalog Peptides
JPT Peptide Technologies has substantial, long-standing expertise in providing peptides, peptidomimetics, and proteins to the global scientific community. Our highly skilled and committed scientific staff ensures that the most appropriate methods and techniques are selected for every synthesis project. All of JPT's catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

Benefits of JPT's Single Catalog Peptides
- Whole production performed in a regulated European environment according to DIN EN ISO 9001:2015 & GCLP standards; audits welcome!
- Synthesis protocols designed to avoid toxic contaminants and side products
- Provision of freeze dried aliquots for enhanced stability
- Proven track record for applications in clinical studies


Read References with Amyloid Beta A4 Peptides (abeta, aß)

Application Note
"Synthetic Amyloid Beta Peptides Aid Alzheimer Investigation"
Broersen et al., Application Note (2013) (full text)

"Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source. We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle."
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands



Related Products

Beta-Amyloid (1-40); HFIP treated (0.1mg)
Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein
add to cart
Beta-Amyloid (1-40)-Lys(Biotinoyl); HFIP (0.1mg)
Synthetic C-terminally biotinylated peptide derived from the N-terminal region of human Amyloid beta A4 protein
add to cart
Biotinoyl-Beta-Amyloid (1-40); HFIP treated (0.1mg)
Synthetic N-terminally biotinylated peptide derived from the N-terminal region of human Amyloid beta A4 protein
add to cart
S26C-Beta-Amyloid (1-40) Dimer; HFIP treated (0.5mg)
Homodimer of human Amyloid beta A4 peptide (1-40), where Ser 26 is replaced by an Cysteine (Cys) that is used for dimerization
add to cart


SARS COV-2 Mass Spec Reference Kit Released!:

SARS-CoV-2 SpikeMix  for Mass Spectrometry covers spike, NCAP, VME-1 & ORF9B
(July 2020)
Read more

New! SARS-CoV-2 Epitope Mapping Peptide Sets

Save time and samples and check our new SARS-CoV-2 Epitope Mapping Peptide Sets (EMPS).
(Apr 2020)
Read more

> Read more news!

Quality Assurance

All production is performed according to ISO 9001:2015 standards.

ISO 9001

Stay in touch and be the first to receive the latest news!

Contact us:

JPT Peptide Technologies GmbH
Volmerstrasse 5
12489 Berlin, Germany
Technical Support:
T: +49-30-6392-7878
X: +49-30-6392-7888
USA & Canada:
T: 1.888.JPT.COM0 (1.888.578.2660)
X: 1.888.JPT.COM6 (1.888.578.2666)